Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily) beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins) an RNA-binding domain |
Protein Neuro-oncological ventral antigen 2, nova-2, KH3 [54795] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54796] (2 PDB entries) |
Domain d1ec6a1: 1ec6 A:5-90 [38804] Other proteins in same PDB: d1ec6a2, d1ec6b2 protein/RNA complex |
PDB Entry: 1ec6 (more details), 2.4 Å
SCOPe Domain Sequences for d1ec6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ec6a1 d.51.1.1 (A:5-90) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} kelveiavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspaa tqaaqylisqrvtyeqgvrasnpqkv
Timeline for d1ec6a1: