Lineage for d6vqof1 (6vqo F:2-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2938107Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (52 PDB entries)
    Uniprot P01901 22-299
  8. 2938182Domain d6vqof1: 6vqo F:2-181 [388033]
    Other proteins in same PDB: d6vqoa2, d6vqob1, d6vqob2, d6vqod1, d6vqod2, d6vqoe1, d6vqoe2, d6vqof2, d6vqog1, d6vqog2, d6vqoh1, d6vqoh2, d6vqoj1, d6vqoj2
    automated match to d1fo0h2

Details for d6vqof1

PDB Entry: 6vqo (more details), 3 Å

PDB Description: t cell receptor-p53-hla-a2 complex
PDB Compounds: (F:) MHC class I antigen

SCOPe Domain Sequences for d6vqof1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vqof1 d.19.1.1 (F:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
shsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeywd
getrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydgk
dyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlqr

SCOPe Domain Coordinates for d6vqof1:

Click to download the PDB-style file with coordinates for d6vqof1.
(The format of our PDB-style files is described here.)

Timeline for d6vqof1: