Lineage for d1dt4a_ (1dt4 A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.51: KH-domain [54790] (1 superfamily) Superfamily d.51.1: KH-domain [54791] (1 family) 
Family d.51.1.1: KH-domain [54792] (6 proteins) 
Protein Neuro-oncological ventral antigen 1, nova-1, KH3 [54793] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54794] (1 PDB entry) 
Domain d1dt4a_: 1dt4 A: [38799]
Details for d1dt4a_
PDB Entry: 1dt4 (more details), 2.6 Å
PDB Description: crystal structure of nova-1 kh3 k-homology rna-binding domain
SCOP Domain Sequences for d1dt4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dt4a_ d.51.1.1 (A:) Neuro-oncological ventral antigen 1, nova-1, KH3 {Human (Homo sapiens)}
mkdvveiavpenlvgailgkggktlveyqeltgcriqiskkgeflpgtrnrkvtitgtpa
atqaaqylitqri
SCOP Domain Coordinates for d1dt4a_:
Click to download the PDB-style file with coordinates for d1dt4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dt4a_:
- d1dt4a_ appears in SCOP 1.57
- d1dt4a_ appears in the current release, SCOPe 2.08
View in 3D