Lineage for d6v44e_ (6v44 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775598Species Influenza a virus (a/swine/missouri/a01727926/2015(h4n6)) [TaxId:1792497] [387944] (1 PDB entry)
  8. 2775601Domain d6v44e_: 6v44 E: [387957]
    Other proteins in same PDB: d6v44b_, d6v44d_, d6v44f_
    automated match to d2hmga_
    complexed with nag

Details for d6v44e_

PDB Entry: 6v44 (more details), 2.2 Å

PDB Description: the crystal structure of hemagglutinin from swine influenza virus a/swine/missouri/a01727926/2015
PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d6v44e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v44e_ b.19.1.2 (E:) Hemagglutinin {Influenza a virus (a/swine/missouri/a01727926/2015(h4n6)) [TaxId: 1792497]}
ytgnpviclghhavpngtmvktltddqievvtaqelvesqhlpelcpsplrlvdgqtcdi
vngalgspgcdhlngaewdvfierptavdtcypfdvpdyqslrsilanngkfefiaeefq
wntvkqngksgackranvndffnrlnwltksdgnayplqnltkvnngdyarlyiwgvhhp
stdteqtnlyknnpgrvtvstqtsqtsvvpnigsrpwvrglssrisfywtivepgdlivf
ntignliaprghyklnsqkkstilntavpigscvskchtdrgsitttkpfqnisrisigd
cpkyvkqgslklatgmrnip

SCOPe Domain Coordinates for d6v44e_:

Click to download the PDB-style file with coordinates for d6v44e_.
(The format of our PDB-style files is described here.)

Timeline for d6v44e_: