SCOP 1.55: Domain d1hnxe2: 1hnx E:5-73

Lineage for d1hnxe2 (1hnx E:5-73)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.50: dsRBD-like [54767] (3 superfamilies)

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (2 families)

5. Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)

6. Protein Ribosomal S5 protein, N-terminal domain [54779] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54781] (6 PDB entries)

8. Domain d1hnxe2: 1hnx E:5-73 [38793]
   Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_

Details for d1hnxe2

PDB Entry: 1hnx, 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin

SCOP Domain Sequences for d1hnxe2:

Sequence; same for both SEQRES and ATOM records:

>d1hnxe2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn

Timeline for d1hnxe2:

• d1hnxe2 appears in SCOP 1.57
  
• d1hnxe2 appears in the current release, SCOPe 2.08