Lineage for d1hnwe2 (1hnw E:5-73)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79728Fold d.50: dsRBD-like [54767] (3 superfamilies)
  4. 79729Superfamily d.50.1: dsRNA-binding domain-like [54768] (2 families) (S)
  5. 79746Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
  6. 79747Protein Ribosomal S5 protein, N-terminal domain [54779] (2 species)
  7. 79750Species Thermus thermophilus [TaxId:274] [54781] (10 PDB entries)
  8. 79756Domain d1hnwe2: 1hnw E:5-73 [38792]
    Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_

Details for d1hnwe2

PDB Entry: 1hnw (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

SCOP Domain Sequences for d1hnwe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnwe2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn

SCOP Domain Coordinates for d1hnwe2:

Click to download the PDB-style file with coordinates for d1hnwe2.
(The format of our PDB-style files is described here.)

Timeline for d1hnwe2: