| Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
| Fold d.50: dsRBD-like [54767] (3 superfamilies) |
Superfamily d.50.1: dsRNA-binding domain-like [54768] (2 families) ![]() |
| Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein) |
| Protein Ribosomal S5 protein, N-terminal domain [54779] (2 species) |
| Species Thermus thermophilus [TaxId:274] [54781] (6 PDB entries) |
| Domain d1hnwe2: 1hnw E:5-73 [38792] Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_ |
PDB Entry: 1hnw (more details), 3.4 Å
SCOP Domain Sequences for d1hnwe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnwe2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn
Timeline for d1hnwe2: