SCOP 1.59: Domain d1hr0e2: 1hr0 E:5-73

Lineage for d1hr0e2 (1hr0 E:5-73)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.50: dsRBD-like [54767] (3 superfamilies)

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (2 families)

5. Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)

6. Protein Ribosomal S5 protein, N-terminal domain [54779] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54781] (10 PDB entries)

8. Domain d1hr0e2: 1hr0 E:5-73 [38790]
   Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_

Details for d1hr0e2

PDB Entry: 1hr0, 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit

SCOP Domain Sequences for d1hr0e2:

Sequence; same for both SEQRES and ATOM records:

>d1hr0e2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn

Timeline for d1hr0e2:

• d1hr0e2 first appeared (with stable ids) in SCOP 1.55
  
• d1hr0e2 appears in SCOP 1.57
  
• d1hr0e2 appears in SCOP 1.61
  
• d1hr0e2 appears in the current release, SCOPe 2.08