Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) |
Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein) |
Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species) lacks the N-terminal helix |
Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries) Uniprot P27152 |
Domain d1fjge2: 1fjg E:5-73 [38789] Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgc2, d1fjgd_, d1fjge1, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_ complexed with mg, par, scm, sry, zn |
PDB Entry: 1fjg (more details), 3 Å
SCOPe Domain Sequences for d1fjge2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fjge2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]} dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr nmvevplqn
Timeline for d1fjge2: