Lineage for d1fjfe2 (1fjf E:5-73)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32111Fold d.50: dsRBD-like [54767] (3 superfamilies)
  4. 32112Superfamily d.50.1: dsRNA-binding domain-like [54768] (2 families) (S)
  5. 32129Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
  6. 32130Protein Ribosomal S5 protein, N-terminal domain [54779] (2 species)
  7. 32133Species Thermus thermophilus [TaxId:274] [54781] (6 PDB entries)
  8. 32134Domain d1fjfe2: 1fjf E:5-73 [38788]
    Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_

Details for d1fjfe2

PDB Entry: 1fjf (more details), 3.05 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit

SCOP Domain Sequences for d1fjfe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjfe2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn

SCOP Domain Coordinates for d1fjfe2:

Click to download the PDB-style file with coordinates for d1fjfe2.
(The format of our PDB-style files is described here.)

Timeline for d1fjfe2: