SCOPe 2.07: Domain d1pkpa2: 1pkp A:4-77

Lineage for d1pkpa2 (1pkp A:4-77)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families)

5. Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
   automatically mapped to Pfam PF00333

6. Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
   lacks the N-terminal helix

7. Species Bacillus stearothermophilus [TaxId:1422] [54780] (1 PDB entry)

8. Domain d1pkpa2: 1pkp A:4-77 [38787]
   Other proteins in same PDB: d1pkpa1

Details for d1pkpa2

PDB Entry: 1pkp, 2.8 Å

PDB Description: the structure of ribosomal protein s5 reveals sites of interaction with 16s rrna

PDB Compounds: (A:) ribosomal protein s5

SCOPe Domain Sequences for d1pkpa2:

Sequence; same for both SEQRES and ATOM records:

>d1pkpa2 d.50.1.2 (A:4-77) Ribosomal S5 protein, N-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
inpnkleleervvavnrvakvvkggrrlrfsalvvvgdknghvgfgtgkaqevpeairka
iedakknlievpiv

Timeline for d1pkpa2:

• d1pkpa2 first appeared (with stable ids) in SCOP 1.55, called d1pkp_2
  
• d1pkpa2 appears in SCOPe 2.06
  
• d1pkpa2 appears in the current release, SCOPe 2.08