Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) |
Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein) automatically mapped to Pfam PF00333 |
Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species) lacks the N-terminal helix |
Species Bacillus stearothermophilus [TaxId:1422] [54780] (1 PDB entry) |
Domain d1pkpa2: 1pkp A:4-77 [38787] Other proteins in same PDB: d1pkpa1 |
PDB Entry: 1pkp (more details), 2.8 Å
SCOPe Domain Sequences for d1pkpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pkpa2 d.50.1.2 (A:4-77) Ribosomal S5 protein, N-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} inpnkleleervvavnrvakvvkggrrlrfsalvvvgdknghvgfgtgkaqevpeairka iedakknlievpiv
Timeline for d1pkpa2: