SCOP 1.57: Domain d1pkp_2: 1pkp 4-77

Lineage for d1pkp_2 (1pkp 4-77)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.50: dsRBD-like [54767] (3 superfamilies)

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (2 families)

5. Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)

6. Protein Ribosomal S5 protein, N-terminal domain [54779] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [54780] (1 PDB entry)

8. Domain d1pkp_2: 1pkp 4-77 [38787]
   Other proteins in same PDB: d1pkp_1

Details for d1pkp_2

PDB Entry: 1pkp, 2.8 Å

PDB Description: the structure of ribosomal protein s5 reveals sites of interaction with 16s rrna

SCOP Domain Sequences for d1pkp_2:

Sequence; same for both SEQRES and ATOM records:

>d1pkp_2 d.50.1.2 (4-77) Ribosomal S5 protein, N-terminal domain {Bacillus stearothermophilus}
inpnkleleervvavnrvakvvkggrrlrfsalvvvgdknghvgfgtgkaqevpeairka
iedakknlievpiv

Timeline for d1pkp_2:

• d1pkp_2 first appeared (with stable ids) in SCOP 1.55
  
• d1pkp_2 appears in SCOP 1.59
  
• d1pkp_2 appears in the current release, SCOPe 2.08, called d1pkpa2