Lineage for d1pkp_2 (1pkp 4-77)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32111Fold d.50: dsRBD-like [54767] (3 superfamilies)
  4. 32112Superfamily d.50.1: dsRNA-binding domain-like [54768] (2 families) (S)
  5. 32129Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
  6. 32130Protein Ribosomal S5 protein, N-terminal domain [54779] (2 species)
  7. 32131Species Bacillus stearothermophilus [TaxId:1422] [54780] (1 PDB entry)
  8. 32132Domain d1pkp_2: 1pkp 4-77 [38787]
    Other proteins in same PDB: d1pkp_1

Details for d1pkp_2

PDB Entry: 1pkp (more details), 2.8 Å

PDB Description: the structure of ribosomal protein s5 reveals sites of interaction with 16s rrna

SCOP Domain Sequences for d1pkp_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkp_2 d.50.1.2 (4-77) Ribosomal S5 protein, N-terminal domain {Bacillus stearothermophilus}
inpnkleleervvavnrvakvvkggrrlrfsalvvvgdknghvgfgtgkaqevpeairka
iedakknlievpiv

SCOP Domain Coordinates for d1pkp_2:

Click to download the PDB-style file with coordinates for d1pkp_2.
(The format of our PDB-style files is described here.)

Timeline for d1pkp_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pkp_1