Lineage for d1pkpa2 (1pkp A:4-77)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946839Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2946840Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2946921Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
    automatically mapped to Pfam PF00333
  6. 2946922Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
    lacks the N-terminal helix
  7. 2946923Species Bacillus stearothermophilus [TaxId:1422] [54780] (1 PDB entry)
  8. 2946924Domain d1pkpa2: 1pkp A:4-77 [38787]
    Other proteins in same PDB: d1pkpa1

Details for d1pkpa2

PDB Entry: 1pkp (more details), 2.8 Å

PDB Description: the structure of ribosomal protein s5 reveals sites of interaction with 16s rrna
PDB Compounds: (A:) ribosomal protein s5

SCOPe Domain Sequences for d1pkpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkpa2 d.50.1.2 (A:4-77) Ribosomal S5 protein, N-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
inpnkleleervvavnrvakvvkggrrlrfsalvvvgdknghvgfgtgkaqevpeairka
iedakknlievpiv

SCOPe Domain Coordinates for d1pkpa2:

Click to download the PDB-style file with coordinates for d1pkpa2.
(The format of our PDB-style files is described here.)

Timeline for d1pkpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pkpa1