Lineage for d1qu6a2 (1qu6 A:91-179)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191596Fold d.50: dsRBD-like [54767] (3 superfamilies)
  4. 191597Superfamily d.50.1: dsRNA-binding domain-like [54768] (2 families) (S)
  5. 191598Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (4 proteins)
  6. 191603Protein dsRNA-dependent protein kinase pkr [54774] (1 species)
  7. 191604Species Human (Homo sapiens) [TaxId:9606] [54775] (1 PDB entry)
  8. 191606Domain d1qu6a2: 1qu6 A:91-179 [38785]

Details for d1qu6a2

PDB Entry: 1qu6 (more details)

PDB Description: structure of the double-stranded rna-binding domain of the protein kinase pkr reveals the molecular basis of its dsrna-mediated activation

SCOP Domain Sequences for d1qu6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens)}
lltttnsseglsmgnyiglinriaqkkrltvnyeqcasgvhgpegfhykckmgqkeysig
tgstkqeakqlaaklaylqilseetgsgc

SCOP Domain Coordinates for d1qu6a2:

Click to download the PDB-style file with coordinates for d1qu6a2.
(The format of our PDB-style files is described here.)

Timeline for d1qu6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qu6a1