SCOP 1.59: Domain d1qu6a2: 1qu6 A:91-179

Lineage for d1qu6a2 (1qu6 A:91-179)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.50: dsRBD-like [54767] (3 superfamilies)

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (2 families)

5. Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (4 proteins)

6. Protein dsRNA-dependent protein kinase pkr [54774] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54775] (1 PDB entry)

8. Domain d1qu6a2: 1qu6 A:91-179 [38785]

Details for d1qu6a2

PDB Entry: 1qu6

PDB Description: structure of the double-stranded rna-binding domain of the protein kinase pkr reveals the molecular basis of its dsrna-mediated activation

SCOP Domain Sequences for d1qu6a2:

Sequence; same for both SEQRES and ATOM records:

>d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens)}
lltttnsseglsmgnyiglinriaqkkrltvnyeqcasgvhgpegfhykckmgqkeysig
tgstkqeakqlaaklaylqilseetgsgc

Timeline for d1qu6a2:

• d1qu6a2 first appeared (with stable ids) in SCOP 1.55
  
• d1qu6a2 appears in SCOP 1.57
  
• d1qu6a2 appears in SCOP 1.61
  
• d1qu6a2 appears in the current release, SCOPe 2.08