Lineage for d1qu6a2 (1qu6 A:91-175)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946839Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2946840Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2946841Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 2946853Protein dsRNA-dependent protein kinase pkr [54774] (2 species)
    contains tandem repeat of two dsRBD
  7. 2946854Species Human (Homo sapiens) [TaxId:9606] [54775] (1 PDB entry)
  8. 2946856Domain d1qu6a2: 1qu6 A:91-175 [38785]
    Other proteins in same PDB: d1qu6a3, d1qu6a4

Details for d1qu6a2

PDB Entry: 1qu6 (more details)

PDB Description: structure of the double-stranded rna-binding domain of the protein kinase pkr reveals the molecular basis of its dsrna-mediated activation
PDB Compounds: (A:) protein kinase pkr

SCOPe Domain Sequences for d1qu6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qu6a2 d.50.1.1 (A:91-175) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]}
lltttnsseglsmgnyiglinriaqkkrltvnyeqcasgvhgpegfhykckmgqkeysig
tgstkqeakqlaaklaylqilseet

SCOPe Domain Coordinates for d1qu6a2:

Click to download the PDB-style file with coordinates for d1qu6a2.
(The format of our PDB-style files is described here.)

Timeline for d1qu6a2: