Lineage for d1stu__ (1stu -)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191596Fold d.50: dsRBD-like [54767] (3 superfamilies)
  4. 191597Superfamily d.50.1: dsRNA-binding domain-like [54768] (2 families) (S)
  5. 191598Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (4 proteins)
  6. 191610Protein Staufen, domain III [54772] (1 species)
  7. 191611Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [54773] (2 PDB entries)
  8. 191612Domain d1stu__: 1stu - [38782]

Details for d1stu__

PDB Entry: 1stu (more details)

PDB Description: double stranded rna binding domain

SCOP Domain Sequences for d1stu__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1stu__ d.50.1.1 (-) Staufen, domain III {Fruit fly (Drosophila melanogaster)}
pisqvheigikrnmtvhfkvlreegpahmknfitacivgsivtegegngkkvskkraaek
mlvelqkl

SCOP Domain Coordinates for d1stu__:

Click to download the PDB-style file with coordinates for d1stu__.
(The format of our PDB-style files is described here.)

Timeline for d1stu__: