Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [197337] (3 PDB entries) |
Domain d6lsaa_: 6lsa A: [387742] automated match to d5b21a_ complexed with nag |
PDB Entry: 6lsa (more details), 2.2 Å
SCOPe Domain Sequences for d6lsaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lsaa_ b.1.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} dsmygfigtdvvlhcsfanplpgvkitqvtwqkatngskqnvaiynpamgvsvlapyrer veflrpsftdgtirlsrleledegvyicefatfpagnresqlnltvmak
Timeline for d6lsaa_: