Lineage for d1mmsa2 (1mms A:8-70)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79693Fold d.47: Ribosomal protein L11, N-terminal domain [54746] (1 superfamily)
  4. 79694Superfamily d.47.1: Ribosomal protein L11, N-terminal domain [54747] (1 family) (S)
  5. 79695Family d.47.1.1: Ribosomal protein L11, N-terminal domain [54748] (1 protein)
  6. 79696Protein Ribosomal protein L11, N-terminal domain [54749] (1 species)
  7. 79697Species Thermotoga maritima [TaxId:243274] [54750] (1 PDB entry)
  8. 79698Domain d1mmsa2: 1mms A:8-70 [38766]
    Other proteins in same PDB: d1mmsa1, d1mmsb1

Details for d1mmsa2

PDB Entry: 1mms (more details), 2.57 Å

PDB Description: crystal structure of the ribosomal protein l11-rna complex

SCOP Domain Sequences for d1mmsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmsa2 d.47.1.1 (A:8-70) Ribosomal protein L11, N-terminal domain {Thermotoga maritima}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fii

SCOP Domain Coordinates for d1mmsa2:

Click to download the PDB-style file with coordinates for d1mmsa2.
(The format of our PDB-style files is described here.)

Timeline for d1mmsa2:

Domains from same chain:
(mouse over for more information)
d1mmsa1
Domains from other chains:
(mouse over for more information)
d1mmsb1