SCOPe 2.08: Domain d6xxng1: 6xxn G:6-126

Lineage for d6xxng1 (6xxn G:6-126)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)

8. Domain d6xxng1: 6xxn G:6-126 [387642]
   Other proteins in same PDB: d6xxna2, d6xxnb2, d6xxnc2, d6xxnd2, d6xxne2, d6xxnf2, d6xxng2, d6xxnh2
   automated match to d1mqkh_
   complexed with so4

Details for d6xxng1

PDB Entry: 6xxn, 2.65 Å

PDB Description: crystal structure of nb7, a nanobody targeting prostate specific membrane antigen

PDB Compounds: (G:) NB_7_g

SCOPe Domain Sequences for d6xxng1:

Sequence; same for both SEQRES and ATOM records:

>d6xxng1 b.1.1.1 (G:6-126) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
esgggsvtaggslrlsctapgytdsnyymswfrqapgkerewvagvntgrgstsyadsvk
grftisqdnakntmflqmnslkpedtaiyycavaachfcdslpktqdeyilwgqgtqvtv
s

Timeline for d6xxng1:

• d6xxng1 first appeared in SCOPe 2.07