Class b: All beta proteins [48724] (178 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (21 species) not a true protein |
Species Unidentified influenza virus [TaxId:11309] [364253] (3 PDB entries) |
Domain d6y5he_: 6y5h E: [387633] Other proteins in same PDB: d6y5hb_, d6y5hd_, d6y5hf_ automated match to d3vuna_ complexed with bma, man, nag |
PDB Entry: 6y5h (more details), 3 Å
SCOPe Domain Sequences for d6y5he_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6y5he_ b.19.1.2 (E:) automated matches {Unidentified influenza virus [TaxId: 11309]} nstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctli dallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftw tgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgihhpst nqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvins ngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpk yvkqntlklatgmrnvpe
Timeline for d6y5he_: