Lineage for d6y5he_ (6y5h E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385196Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2385678Protein automated matches [190291] (21 species)
    not a true protein
  7. 2385877Species Unidentified influenza virus [TaxId:11309] [364253] (3 PDB entries)
  8. 2385883Domain d6y5he_: 6y5h E: [387633]
    Other proteins in same PDB: d6y5hb_, d6y5hd_, d6y5hf_
    automated match to d3vuna_
    complexed with bma, man, nag

Details for d6y5he_

PDB Entry: 6y5h (more details), 3 Å

PDB Description: ectodomain of x-31 haemagglutinin at ph 5 (state i)
PDB Compounds: (E:) X-31 Influenza Haemagglutinin HA1

SCOPe Domain Sequences for d6y5he_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y5he_ b.19.1.2 (E:) automated matches {Unidentified influenza virus [TaxId: 11309]}
nstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctli
dallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftw
tgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgihhpst
nqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvins
ngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpk
yvkqntlklatgmrnvpe

SCOPe Domain Coordinates for d6y5he_:

Click to download the PDB-style file with coordinates for d6y5he_.
(The format of our PDB-style files is described here.)

Timeline for d6y5he_: