SCOP 1.71: Domain d1dd4b2: 1dd4 B:58-128

Lineage for d1dd4b2 (1dd4 B:58-128)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.45: ClpS-like [54735] (1 superfamily)
   beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta

4. Superfamily d.45.1: ClpS-like [54736] (2 families)

5. Family d.45.1.1: Ribosomal protein L7/12, C-terminal domain [54737] (1 protein)

6. Protein Ribosomal protein L7/12, C-terminal domain [54738] (2 species)

7. Species Thermotoga maritima [TaxId:243274] [54740] (2 PDB entries)

8. Domain d1dd4b2: 1dd4 B:58-128 [38763]
   Other proteins in same PDB: d1dd4a1, d1dd4b1, d1dd4c_, d1dd4d_
   complexed with tbr

Details for d1dd4b2

PDB Entry: 1dd4, 2.4 Å

PDB Description: Crystal structure of ribosomal protein l12 from thermotoga maritim

SCOP Domain Sequences for d1dd4b2:

Sequence; same for both SEQRES and ATOM records:

>d1dd4b2 d.45.1.1 (B:58-128) Ribosomal protein L7/12, C-terminal domain {Thermotoga maritima}
efdvvlksfgqnkiqvikvvreitglglkeakdlvekagspdaviksgvskeeaeeikkk
leeagaevelk

Timeline for d1dd4b2:

• d1dd4b2 first appeared (with stable ids) in SCOP 1.55
  
• d1dd4b2 appears in SCOP 1.69
  
• d1dd4b2 appears in SCOP 1.73
  
• d1dd4b2 appears in the current release, SCOPe 2.08