Lineage for d1dd4a2 (1dd4 A:58-128)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1025155Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. 1025156Superfamily d.45.1: ClpS-like [54736] (3 families) (S)
  5. 1025157Family d.45.1.1: Ribosomal protein L7/12, C-terminal domain [54737] (1 protein)
  6. 1025158Protein Ribosomal protein L7/12, C-terminal domain [54738] (3 species)
  7. 1025173Species Thermotoga maritima [TaxId:2336] [54740] (3 PDB entries)
  8. 1025176Domain d1dd4a2: 1dd4 A:58-128 [38762]
    Other proteins in same PDB: d1dd4a1, d1dd4b1, d1dd4c_, d1dd4d_
    complexed with tbr

Details for d1dd4a2

PDB Entry: 1dd4 (more details), 2.4 Å

PDB Description: Crystal structure of ribosomal protein l12 from thermotoga maritim
PDB Compounds: (A:) 50S ribosomal protein L7/L12

SCOPe Domain Sequences for d1dd4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dd4a2 d.45.1.1 (A:58-128) Ribosomal protein L7/12, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
efdvvlksfgqnkiqvikvvreitglglkeakdlvekagspdaviksgvskeeaeeikkk
leeagaevelk

SCOPe Domain Coordinates for d1dd4a2:

Click to download the PDB-style file with coordinates for d1dd4a2.
(The format of our PDB-style files is described here.)

Timeline for d1dd4a2: