SCOP 1.57: Domain d1dd3a2: 1dd3 A:58-128

Lineage for d1dd3a2 (1dd3 A:58-128)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.45: Ribosomal protein L7/12, C-terminal domain [54735] (1 superfamily)

4. Superfamily d.45.1: Ribosomal protein L7/12, C-terminal domain [54736] (1 family)

5. Family d.45.1.1: Ribosomal protein L7/12, C-terminal domain [54737] (1 protein)

6. Protein Ribosomal protein L7/12, C-terminal domain [54738] (2 species)

7. Species Thermotoga maritima [TaxId:243274] [54740] (2 PDB entries)

8. Domain d1dd3a2: 1dd3 A:58-128 [38760]
   Other proteins in same PDB: d1dd3a1, d1dd3b1, d1dd3c1, d1dd3d1

Details for d1dd3a2

PDB Entry: 1dd3, 2 Å

PDB Description: crystal structure of ribosomal protein l12 from thermotoga maritima

SCOP Domain Sequences for d1dd3a2:

Sequence; same for both SEQRES and ATOM records:

>d1dd3a2 d.45.1.1 (A:58-128) Ribosomal protein L7/12, C-terminal domain {Thermotoga maritima}
efdvvlksfgqnkiqvikvvreitglglkeakdlvekagspdaviksgvskeeaeeikkk
leeagaevelk

Timeline for d1dd3a2:

• d1dd3a2 first appeared (with stable ids) in SCOP 1.55
  
• d1dd3a2 appears in SCOP 1.59
  
• d1dd3a2 appears in the current release, SCOPe 2.08