SCOPe 2.08: Domain d6sbuh1: 6sbu H:2-160

Lineage for d6sbuh1 (6sbu H:2-160)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (19 species)

7. Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (39 PDB entries)

8. Domain d6sbuh1: 6sbu H:2-160 [387503]
   Other proteins in same PDB: d6sbua2, d6sbub2, d6sbuc2, d6sbud2, d6sbue2, d6sbuf2, d6sbug2, d6sbuh2
   automated match to d4jnka1
   complexed with l5n, nai

Details for d6sbuh1

PDB Entry: 6sbu, 2.91 Å

PDB Description: x-ray structure of human ldha with an allosteric inhibitor (compound 3)

PDB Compounds: (H:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d6sbuh1:

Sequence, based on SEQRES records:

>d6sbuh1 c.2.1.5 (H:2-160) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig

Sequence, based on observed residues (ATOM records):

>d6sbuh1 c.2.1.5 (H:2-160) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllktpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemmd
lqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfiipnv
vkyspnckllivsnpvdiltyvawkisgfpknrvig

Timeline for d6sbuh1:

• d6sbuh1 first appeared in SCOPe 2.07