Lineage for d1isbb2 (1isb B:83-192)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722119Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 722120Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 722121Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 722149Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)
  7. 722198Species Escherichia coli [TaxId:562] [54727] (6 PDB entries)
  8. 722212Domain d1isbb2: 1isb B:83-192 [38729]
    Other proteins in same PDB: d1isba1, d1isbb1
    complexed with fe; mutant

Details for d1isbb2

PDB Entry: 1isb (more details), 1.85 Å

PDB Description: structure-function in e. coli iron superoxide dismutase: comparisons with the manganese enzyme from t. thermophilus
PDB Compounds: (B:) iron(III) superoxide dismutase

SCOP Domain Sequences for d1isbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1isbb2 d.44.1.1 (B:83-192) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]}
naggeptgkvaeaiaasfgsfadfkaqftdaaiknfgsgwtwlvknsdgklaivstsnag
tplttdatplltvdvwehayyidyrnarpgylehfwalvnwefvaknlaa

SCOP Domain Coordinates for d1isbb2:

Click to download the PDB-style file with coordinates for d1isbb2.
(The format of our PDB-style files is described here.)

Timeline for d1isbb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1isbb1