Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (20 species) not a true protein |
Species Bordetella pertussis [TaxId:520] [386856] (1 PDB entry) |
Domain d6ro0i1: 6ro0 I:4-89 [387029] Other proteins in same PDB: d6ro0a_, d6ro0b1, d6ro0b2, d6ro0c2, d6ro0d_, d6ro0e_, d6ro0f_, d6ro0g_, d6ro0h1, d6ro0h2, d6ro0i2, d6ro0j_, d6ro0k_, d6ro0l_ automated match to d1prtc2 complexed with gol |
PDB Entry: 6ro0 (more details), 2.13 Å
SCOPe Domain Sequences for d6ro0i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ro0i1 d.169.1.0 (I:4-89) automated matches {Bordetella pertussis [TaxId: 520]} givippkalftqqggaygrcpngtraltvaelrgnaelqtylrqitpgwsiyglydgtyl gqayggiikdappgagfiyretfcit
Timeline for d6ro0i1: