Lineage for d6ro0i1 (6ro0 I:4-89)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608201Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2608202Protein automated matches [190159] (20 species)
    not a true protein
  7. 2608206Species Bordetella pertussis [TaxId:520] [386856] (1 PDB entry)
  8. 2608208Domain d6ro0i1: 6ro0 I:4-89 [387029]
    Other proteins in same PDB: d6ro0a_, d6ro0b1, d6ro0b2, d6ro0c2, d6ro0d_, d6ro0e_, d6ro0f_, d6ro0g_, d6ro0h1, d6ro0h2, d6ro0i2, d6ro0j_, d6ro0k_, d6ro0l_
    automated match to d1prtc2
    complexed with gol

Details for d6ro0i1

PDB Entry: 6ro0 (more details), 2.13 Å

PDB Description: crystal structure of genetically detoxified pertussis toxin gdpt.
PDB Compounds: (I:) Islet-activating protein S3

SCOPe Domain Sequences for d6ro0i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ro0i1 d.169.1.0 (I:4-89) automated matches {Bordetella pertussis [TaxId: 520]}
givippkalftqqggaygrcpngtraltvaelrgnaelqtylrqitpgwsiyglydgtyl
gqayggiikdappgagfiyretfcit

SCOPe Domain Coordinates for d6ro0i1:

Click to download the PDB-style file with coordinates for d6ro0i1.
(The format of our PDB-style files is described here.)

Timeline for d6ro0i1: