SCOP 1.55: Domain d1mngb2: 1mng B:93-203

Lineage for d1mngb2 (1mng B:93-203)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family)

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (3 species)

7. Species Thermus thermophilus [TaxId:274] [54723] (2 PDB entries)

8. Domain d1mngb2: 1mng B:93-203 [38702]
   Other proteins in same PDB: d1mnga1, d1mngb1

Details for d1mngb2

PDB Entry: 1mng, 1.8 Å

PDB Description: structure-function in e. coli iron superoxide dismutase: comparisons with the manganese enzyme from t. thermophilus

SCOP Domain Sequences for d1mngb2:

Sequence; same for both SEQRES and ATOM records:

>d1mngb2 d.44.1.1 (B:93-203) Mn superoxide dismutase (MnSOD) {Thermus thermophilus}
ggakepvgelkkaideqfggfqalkekltqaamgrfgsgwawlvkdpfgklhvlstpnqd
npvmegftpivgidvwehayylkyqnrradylqaiwnvlnwdvaeeffkka

Timeline for d1mngb2:

• d1mngb2 appears in SCOP 1.57
  
• d1mngb2 appears in the current release, SCOPe 2.08