Lineage for d6ro0h2 (6ro0 H:90-199)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2397831Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2398373Protein automated matches [190381] (11 species)
    not a true protein
  7. 2398374Species Bordetella pertussis [TaxId:520] [386828] (1 PDB entry)
  8. 2398380Domain d6ro0h2: 6ro0 H:90-199 [386979]
    Other proteins in same PDB: d6ro0a_, d6ro0b1, d6ro0c1, d6ro0g_, d6ro0h1, d6ro0i1
    automated match to d1prtb1
    complexed with gol

Details for d6ro0h2

PDB Entry: 6ro0 (more details), 2.13 Å

PDB Description: crystal structure of genetically detoxified pertussis toxin gdpt.
PDB Compounds: (H:) Islet-activating protein S2

SCOPe Domain Sequences for d6ro0h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ro0h2 b.40.2.1 (H:90-199) automated matches {Bordetella pertussis [TaxId: 520]}
ttrntgqpatdhyysnvtatrllsstnsrlcavfvrsgqpvigactspydgkywsmysrl
rkmlyliyvagisvrvhvskeeqyydyedatfetyaltgisicnpgsslc

SCOPe Domain Coordinates for d6ro0h2:

Click to download the PDB-style file with coordinates for d6ro0h2.
(The format of our PDB-style files is described here.)

Timeline for d6ro0h2: