Lineage for d1aipc_ (1aip C:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31952Fold d.43: Elongation factor Ts (EF-Ts), dimerisation domain [54712] (1 superfamily)
  4. 31953Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) (S)
  5. 31954Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (1 protein)
  6. 31955Protein Elongation factor Ts (EF-Ts), dimerisation domain [54715] (2 species)
  7. 31961Species Thermus thermophilus [TaxId:274] [54717] (2 PDB entries)
  8. 31963Domain d1aipc_: 1aip C: [38681]
    Other proteins in same PDB: d1aipa1, d1aipa2, d1aipa3, d1aipb1, d1aipb2, d1aipb3, d1aipe1, d1aipe2, d1aipe3, d1aipf1, d1aipf2, d1aipf3

Details for d1aipc_

PDB Entry: 1aip (more details), 3 Å

PDB Description: ef-tu ef-ts complex from thermus thermophilus

SCOP Domain Sequences for d1aipc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aipc_ d.43.1.1 (C:) Elongation factor Ts (EF-Ts), dimerisation domain {Thermus thermophilus}
sqmelikklreatgagmmdvkraledagwdeekavqllrergamkaakkadrearegiig
hyihhnqrvgvlvelncetdfvarnelfqnlakdlamhiammnpryvsaeeipaeeleke
rqiyiqaalnegkpqqiaekiaegrlkkyleevvlleqpfvkddkvkvkeliqqaiakig
enivvrrfcrfelga

SCOP Domain Coordinates for d1aipc_:

Click to download the PDB-style file with coordinates for d1aipc_.
(The format of our PDB-style files is described here.)

Timeline for d1aipc_:

  • d1aipc_ does not appear in SCOP 1.57