Lineage for d1tfe__ (1tfe -)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503015Fold d.43: Elongation factor Ts (EF-Ts), dimerisation domain [54712] (1 superfamily)
    beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123
  4. 503016Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) (S)
  5. 503017Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (1 protein)
  6. 503018Protein Elongation factor Ts (EF-Ts), dimerisation domain [63422] (2 species)
  7. 503024Species Thermus thermophilus [TaxId:274] [54717] (2 PDB entries)
  8. 503025Domain d1tfe__: 1tfe - [38680]
    dimer of a one subdomain fragment

Details for d1tfe__

PDB Entry: 1tfe (more details), 1.7 Å

PDB Description: dimerization domain of ef-ts from t. thermophilus

SCOP Domain Sequences for d1tfe__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfe__ d.43.1.1 (-) Elongation factor Ts (EF-Ts), dimerisation domain {Thermus thermophilus}
aregiighyihhnqrvgvlvelncetdfvarnelfqnlakdlamhiammnpryvsaeeip
aeelekerqiyiqaalnegkpqqiaekiaegrlkkyleevvlleqpfvkddkvkvkeliq
qaiakigenivvrrfcrfelga

SCOP Domain Coordinates for d1tfe__:

Click to download the PDB-style file with coordinates for d1tfe__.
(The format of our PDB-style files is described here.)

Timeline for d1tfe__: