Lineage for d1efud1 (1efu D:1-139)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31952Fold d.43: Elongation factor Ts (EF-Ts), dimerisation domain [54712] (1 superfamily)
  4. 31953Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) (S)
  5. 31954Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (1 protein)
  6. 31955Protein Elongation factor Ts (EF-Ts), dimerisation domain [54715] (2 species)
  7. 31956Species Escherichia coli [TaxId:562] [54716] (1 PDB entry)
  8. 31959Domain d1efud1: 1efu D:1-139 [38678]
    Other proteins in same PDB: d1efua1, d1efua2, d1efua3, d1efuc1, d1efuc2, d1efuc3

Details for d1efud1

PDB Entry: 1efu (more details), 2.5 Å

PDB Description: elongation factor complex ef-tu/ef-ts from escherichia coli

SCOP Domain Sequences for d1efud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efud1 d.43.1.1 (D:1-139) Elongation factor Ts (EF-Ts), dimerisation domain {Escherichia coli}
aeitaslvkelrertgagmmdckkalteangdielaienmrksgaikaakkagnvaadgv
iktkidgnygiilevncqtdfvakdagfqafadkvldaavagkitdvevlkaqfeeerva
lvakigeninirrvaaleg

SCOP Domain Coordinates for d1efud1:

Click to download the PDB-style file with coordinates for d1efud1.
(The format of our PDB-style files is described here.)

Timeline for d1efud1: