Lineage for d1efub2 (1efu B:140-282)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.43: Elongation factor Ts (EF-Ts), dimerisation domain [54712] (1 superfamily) Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) 
Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (1 protein) Protein Elongation factor Ts (EF-Ts), dimerisation domain [54715] (2 species) 
Species Escherichia coli [TaxId:562] [54716] (1 PDB entry) 
Domain d1efub2: 1efu B:140-282 [38677]
Other proteins in same PDB: d1efua1, d1efua2, d1efua3, d1efuc1, d1efuc2, d1efuc3
Details for d1efub2
PDB Entry: 1efu (more details), 2.5 Å
PDB Description: elongation factor complex ef-tu/ef-ts from escherichia coli
SCOP Domain Sequences for d1efub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efub2 d.43.1.1 (B:140-282) Elongation factor Ts (EF-Ts), dimerisation domain {Escherichia coli}
dvlgsyqhgarigvlvaakgadeelvkhiamhvaaskpefikpedvsaevvekeyqvqld
iamqsgkpkeiaekmvegrmkkftgevsltgqpfvmepsktvgqllkehnaevtgfirfe
vgegiekvetdfaaevaamskqs
SCOP Domain Coordinates for d1efub2:
Click to download the PDB-style file with coordinates for d1efub2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1efub2:
- d1efub2 appears in SCOP 1.57
- d1efub2 appears in the current release, SCOPe 2.08
View in 3D
