Lineage for d1fs2d2 (1fs2 D:2-68)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31889Fold d.42: POZ domain [54694] (1 superfamily)
  4. 31890Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 31902Family d.42.1.2: Tetramerization domain of potassium channels [54701] (5 proteins)
  6. 31906Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species)
  7. 31907Species Human (Homo sapiens) [TaxId:9606] [54711] (3 PDB entries)
  8. 31919Domain d1fs2d2: 1fs2 D:2-68 [38675]
    Other proteins in same PDB: d1fs2a1, d1fs2a2, d1fs2b1, d1fs2c1, d1fs2c2, d1fs2d1

Details for d1fs2d2

PDB Entry: 1fs2 (more details), 2.9 Å

PDB Description: insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

SCOP Domain Sequences for d1fs2d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fs2d2 d.42.1.2 (D:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens)}
psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
d

SCOP Domain Coordinates for d1fs2d2:

Click to download the PDB-style file with coordinates for d1fs2d2.
(The format of our PDB-style files is described here.)

Timeline for d1fs2d2: