SCOP 1.75: Domain d1fs2b2: 1fs2 B:2-68

Lineage for d1fs2b2 (1fs2 B:2-68)

Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.42: POZ domain [54694] (1 superfamily)
core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
Superfamily d.42.1: POZ domain [54695] (2 families)
Family d.42.1.1: BTB/POZ domain [54696] (5 proteins)
Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [54711] (8 PDB entries)
Domain d1fs2b2: 1fs2 B:2-68 [38674]
Other proteins in same PDB: d1fs2a1, d1fs2a2, d1fs2b1, d1fs2c1, d1fs2c2, d1fs2d1

Details for d1fs2b2

PDB Entry: 1fs2 (more details), 2.9 Å

PDB Description: insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

PDB Compounds: (B:) skp1

SCOP Domain Sequences for d1fs2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fs2b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
d

SCOP Domain Coordinates for d1fs2b2:

Click to download the PDB-style file with coordinates for d1fs2b2.
(The format of our PDB-style files is described here.)

Timeline for d1fs2b2: