| Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
| Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (2 families) ![]() |
| Family d.42.1.1: BTB/POZ domain [54696] (5 proteins) |
| Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54711] (5 PDB entries) |
| Domain d1fs2b2: 1fs2 B:2-68 [38674] Other proteins in same PDB: d1fs2a1, d1fs2a2, d1fs2b1, d1fs2c1, d1fs2c2, d1fs2d1 |
PDB Entry: 1fs2 (more details), 2.9 Å
SCOP Domain Sequences for d1fs2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fs2b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens)}
psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
d
Timeline for d1fs2b2: