SCOP 1.55: Domain d1fqvp2: 1fqv P:2-68

Lineage for d1fqvp2 (1fqv P:2-68)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)

4. Superfamily d.42.1: POZ domain [54695] (2 families)

5. Family d.42.1.2: Tetramerization domain of potassium channels [54701] (5 proteins)

6. Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54711] (3 PDB entries)

8. Domain d1fqvp2: 1fqv P:2-68 [38673]
   Other proteins in same PDB: d1fqva1, d1fqva2, d1fqvb1, d1fqvc1, d1fqvc2, d1fqvd1, d1fqve1, d1fqve2, d1fqvf1, d1fqvg1, d1fqvg2, d1fqvh1, d1fqvi1, d1fqvi2, d1fqvj1, d1fqvk1, d1fqvk2, d1fqvl1, d1fqvm1, d1fqvm2, d1fqvn1, d1fqvo1, d1fqvo2, d1fqvp1

Details for d1fqvp2

PDB Entry: 1fqv, 2.8 Å

PDB Description: Insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

SCOP Domain Sequences for d1fqvp2:

Sequence; same for both SEQRES and ATOM records:

>d1fqvp2 d.42.1.2 (P:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens)}
psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
d

Timeline for d1fqvp2:

• d1fqvp2 appears in SCOP 1.57
  
• d1fqvp2 appears in the current release, SCOPe 2.08