![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
![]() | Superfamily d.42.1: POZ domain [54695] (2 families) ![]() |
![]() | Family d.42.1.2: Tetramerization domain of potassium channels [54701] (6 proteins) |
![]() | Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54711] (4 PDB entries) |
![]() | Domain d1fqvd2: 1fqv D:2-68 [38667] Other proteins in same PDB: d1fqva1, d1fqva2, d1fqvb1, d1fqvc1, d1fqvc2, d1fqvd1, d1fqve1, d1fqve2, d1fqvf1, d1fqvg1, d1fqvg2, d1fqvh1, d1fqvi1, d1fqvi2, d1fqvj1, d1fqvk1, d1fqvk2, d1fqvl1, d1fqvm1, d1fqvm2, d1fqvn1, d1fqvo1, d1fqvo2, d1fqvp1 |
PDB Entry: 1fqv (more details), 2.8 Å
SCOP Domain Sequences for d1fqvd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fqvd2 d.42.1.2 (D:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens)} psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd d
Timeline for d1fqvd2:
![]() Domains from other chains: (mouse over for more information) d1fqva1, d1fqva2, d1fqvb1, d1fqvb2, d1fqvc1, d1fqvc2, d1fqve1, d1fqve2, d1fqvf1, d1fqvf2, d1fqvg1, d1fqvg2, d1fqvh1, d1fqvh2, d1fqvi1, d1fqvi2, d1fqvj1, d1fqvj2, d1fqvk1, d1fqvk2, d1fqvl1, d1fqvl2, d1fqvm1, d1fqvm2, d1fqvn1, d1fqvn2, d1fqvo1, d1fqvo2, d1fqvp1, d1fqvp2 |