Lineage for d1qdwe_ (1qdw E:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31889Fold d.42: POZ domain [54694] (1 superfamily)
  4. 31890Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 31902Family d.42.1.2: Tetramerization domain of potassium channels [54701] (5 proteins)
  6. 31923Protein Kv1.2 [54708] (1 species)
  7. 31924Species Rat (Rattus norvegicus) [TaxId:10116] [54709] (3 PDB entries)
  8. 31941Domain d1qdwe_: 1qdw E: [38660]

Details for d1qdwe_

PDB Entry: 1qdw (more details), 2.1 Å

PDB Description: n-terminal domain, voltage-gated potassium channel kv1.2 residues 33-119

SCOP Domain Sequences for d1qdwe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qdwe_ d.42.1.2 (E:) Kv1.2 {Rat (Rattus norvegicus)}
ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
qsggrlrrpvnvpldifseeirfyelg

SCOP Domain Coordinates for d1qdwe_:

Click to download the PDB-style file with coordinates for d1qdwe_.
(The format of our PDB-style files is described here.)

Timeline for d1qdwe_: