SCOPe 2.08: Domain d6jz1b1: 6jz1 B:2-185

Lineage for d6jz1b1 (6jz1 B:2-185)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (51 species)
   not a true protein

7. Species [ruminococcus] gnavus [TaxId:33038] [361223] (3 PDB entries)

8. Domain d6jz1b1: 6jz1 B:2-185 [386584]
   Other proteins in same PDB: d6jz1a2, d6jz1a3, d6jz1b2, d6jz1b3
   automated match to d5c70a1
   complexed with mrd

Details for d6jz1b1

PDB Entry: 6jz1, 1.73 Å

PDB Description: apo structure of b-glucuronidase from ruminococcus gnavus at 1.7 angstrom resolution

PDB Compounds: (B:) beta-glucuronidase

SCOPe Domain Sequences for d6jz1b1:

Sequence; same for both SEQRES and ATOM records:

>d6jz1b1 b.18.1.0 (B:2-185) automated matches {[ruminococcus] gnavus [TaxId: 33038]}
leyselypiqneyrmmqsldgmwkfqfdpeeigkksgwenglpapvsmpvpssfadfftd
hkerdycgdfwyetefylpaewrnkkiwlrfgsithrgtvycngmeitsheggflpvlad
istvakpgqvnqvvvkinnelnetslpcgatkilnngrklakpyfdffnysglqrsvwvi
alpe

Timeline for d6jz1b1:

• d6jz1b1 first appeared in SCOPe 2.07