Lineage for d1qdva_ (1qdv A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.42: POZ domain [54694] (1 superfamily) Superfamily d.42.1: POZ domain [54695] (2 families) 
Family d.42.1.2: Tetramerization domain of potassium channels [54701] (5 proteins) 
Protein Kv1.2 [54708] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [54709] (3 PDB entries) 
Domain d1qdva_: 1qdv A: [38652]
Details for d1qdva_
PDB Entry: 1qdv (more details), 1.6 Å
PDB Description: n-terminal domain, voltage-gated potassium channel kv1.2 residues 33-131
SCOP Domain Sequences for d1qdva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qdva_ d.42.1.2 (A:) Kv1.2 {Rat (Rattus norvegicus)}
ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
qsggrlrrpvnvpldifseeirfyelgeeamemfredeg
SCOP Domain Coordinates for d1qdva_:
Click to download the PDB-style file with coordinates for d1qdva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qdva_:
- d1qdva_ appears in SCOP 1.57
- d1qdva_ appears in the current release, SCOPe 2.08
View in 3D
