Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) |
Superfamily d.42.1: POZ domain [54695] (2 families) |
Family d.42.1.2: Tetramerization domain of potassium channels [54701] (5 proteins) |
Protein Kv1.2 [54708] (1 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [54709] (3 PDB entries) |
Domain d1dsxg_: 1dsx G: [38650] |
PDB Entry: 1dsx (more details), 1.6 Å
SCOP Domain Sequences for d1dsxg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dsxg_ d.42.1.2 (G:) Kv1.2 {Rat (Rattus norvegicus)} ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy qsggrlrrpvnvpldifseeirfyelg
Timeline for d1dsxg_: