Lineage for d1dsxf_ (1dsx F:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647422Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1647423Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1647557Family d.42.1.2: Tetramerization domain of potassium channels [54701] (7 proteins)
  6. 1647564Protein Kv1.2 [54708] (1 species)
  7. 1647565Species Norway rat (Rattus norvegicus) [TaxId:10116] [54709] (3 PDB entries)
  8. 1647571Domain d1dsxf_: 1dsx F: [38649]
    mutant

Details for d1dsxf_

PDB Entry: 1dsx (more details), 1.6 Å

PDB Description: kv1.2 t1 domain, residues 33-119, t46v mutant
PDB Compounds: (F:) protein (kv1.2 voltage-gated potassium channel)

SCOPe Domain Sequences for d1dsxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dsxf_ d.42.1.2 (F:) Kv1.2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
qsggrlrrpvnvpldifseeirfyelg

SCOPe Domain Coordinates for d1dsxf_:

Click to download the PDB-style file with coordinates for d1dsxf_.
(The format of our PDB-style files is described here.)

Timeline for d1dsxf_: