Lineage for d1dsxf_ (1dsx F:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 132737Fold d.42: POZ domain [54694] (1 superfamily)
  4. 132738Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 132752Family d.42.1.2: Tetramerization domain of potassium channels [54701] (5 proteins)
  6. 132773Protein Kv1.2 [54708] (1 species)
  7. 132774Species Rat (Rattus norvegicus) [TaxId:10116] [54709] (3 PDB entries)
  8. 132780Domain d1dsxf_: 1dsx F: [38649]

Details for d1dsxf_

PDB Entry: 1dsx (more details), 1.6 Å

PDB Description: kv1.2 t1 domain, residues 33-119, t46v mutant

SCOP Domain Sequences for d1dsxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dsxf_ d.42.1.2 (F:) Kv1.2 {Rat (Rattus norvegicus)}
ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
qsggrlrrpvnvpldifseeirfyelg

SCOP Domain Coordinates for d1dsxf_:

Click to download the PDB-style file with coordinates for d1dsxf_.
(The format of our PDB-style files is described here.)

Timeline for d1dsxf_: