SCOPe 2.06: Domain d1dsxd_: 1dsx D:

Lineage for d1dsxd_ (1dsx D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.2: Tetramerization domain of potassium channels [54701] (7 proteins)

6. Protein Kv1.2 [54708] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [54709] (3 PDB entries)

8. Domain d1dsxd_: 1dsx D: [38647]
   mutant

Details for d1dsxd_

PDB Entry: 1dsx, 1.6 Å

PDB Description: kv1.2 t1 domain, residues 33-119, t46v mutant

PDB Compounds: (D:) protein (kv1.2 voltage-gated potassium channel)

SCOPe Domain Sequences for d1dsxd_:

Sequence; same for both SEQRES and ATOM records:

>d1dsxd_ d.42.1.2 (D:) Kv1.2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
qsggrlrrpvnvpldifseeirfyelg

Timeline for d1dsxd_:

• d1dsxd_ first appeared (with stable ids) in SCOP 1.55
  
• d1dsxd_ appears in SCOPe 2.05
  
• d1dsxd_ appears in SCOPe 2.07
  
• d1dsxd_ appears in the current release, SCOPe 2.08