Lineage for d1dsxc_ (1dsx C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903244Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1903245Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1903421Family d.42.1.2: Tetramerization domain of potassium channels [54701] (7 proteins)
  6. 1903428Protein Kv1.2 [54708] (1 species)
  7. 1903429Species Norway rat (Rattus norvegicus) [TaxId:10116] [54709] (3 PDB entries)
  8. 1903432Domain d1dsxc_: 1dsx C: [38646]
    mutant

Details for d1dsxc_

PDB Entry: 1dsx (more details), 1.6 Å

PDB Description: kv1.2 t1 domain, residues 33-119, t46v mutant
PDB Compounds: (C:) protein (kv1.2 voltage-gated potassium channel)

SCOPe Domain Sequences for d1dsxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dsxc_ d.42.1.2 (C:) Kv1.2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
qsggrlrrpvnvpldifseeirfyelg

SCOPe Domain Coordinates for d1dsxc_:

Click to download the PDB-style file with coordinates for d1dsxc_.
(The format of our PDB-style files is described here.)

Timeline for d1dsxc_: