Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.2: Tetramerization domain of potassium channels [54701] (7 proteins) |
Protein Kv1.2 [54708] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [54709] (3 PDB entries) |
Domain d1dsxc_: 1dsx C: [38646] mutant |
PDB Entry: 1dsx (more details), 1.6 Å
SCOPe Domain Sequences for d1dsxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dsxc_ d.42.1.2 (C:) Kv1.2 {Norway rat (Rattus norvegicus) [TaxId: 10116]} ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy qsggrlrrpvnvpldifseeirfyelg
Timeline for d1dsxc_: