Lineage for d3kvta_ (3kvt A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647422Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1647423Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1647557Family d.42.1.2: Tetramerization domain of potassium channels [54701] (7 proteins)
  6. 1647558Protein akv3.1 voltage-gated potassium channel [54704] (1 species)
  7. 1647559Species California sea hare (Aplysia californica) [TaxId:6500] [54705] (1 PDB entry)
  8. 1647560Domain d3kvta_: 3kvt A: [38642]
    complexed with zn

Details for d3kvta_

PDB Entry: 3kvt (more details), 2 Å

PDB Description: tetramerization domain from akv3.1 (shaw-subfamily) voltage-gated potassium channel
PDB Compounds: (A:) potassium channel protein shaw

SCOPe Domain Sequences for d3kvta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]}
enrviinvggirhetykatlkkipatrlsrltegmlnydpvlneyffdrhpgvfaqiiny
yrsgklhyptdvcgplfeeelefwgldsnqvepccwmtytahr

SCOPe Domain Coordinates for d3kvta_:

Click to download the PDB-style file with coordinates for d3kvta_.
(The format of our PDB-style files is described here.)

Timeline for d3kvta_: